Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NGFRAP1 protein

This Human NGFRAP1 protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NGFRAP1

UniProt

Q00994

Expression Region

1-111aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-111aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: LBI15B5]
AMM18032V 100 µL

PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: LBI15B5]

Sign In for Pricing
View Details
GENLISA Phosphoenolpyruvate Carboxylase (PEPC) Activity Assay Kit
KBCA1971 96 Tests

GENLISA Phosphoenolpyruvate Carboxylase (PEPC) Activity Assay Kit

Sign In for Pricing
View Details
TIE2, His, Human
Z05880-100 100 µg

TIE2, His, Human

Sign In for Pricing
View Details
MPP6 Antibody
OACA09179-100UL 100 µL

MPP6 Antibody

Sign In for Pricing
View Details
SCmL2 (NM_006089) Human Tagged ORF Clone Lentiviral Particle
RC209060L4V 200 µL

SCmL2 (NM_006089) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GNRPX Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-8576R-BF405 100 µL

GNRPX Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details