Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NGB protein

This Human NGB protein spans the amino acid sequence from region 1-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NGB

UniProt

Q9NPG2

Expression Region

1-151aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Apoptotic, Cancer, Epigenetics, Neuroscience, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-151aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human B7-H7 (223-344) Protein, hFc Tag
orb2321452-01 10 µg

Human B7-H7 (223-344) Protein, hFc Tag

Sign In for Pricing
View Details
Human B7-H7 (223-344) Protein, hFc Tag
orb2321452-02 50 µg

Human B7-H7 (223-344) Protein, hFc Tag

Sign In for Pricing
View Details
Human B7-H7 (223-344) Protein, hFc Tag
orb2321452-03 100 µg

Human B7-H7 (223-344) Protein, hFc Tag

Sign In for Pricing
View Details
TOP2A (phospho-S1106) polyclonal antibody
BS64291-01 50 µL

TOP2A (phospho-S1106) polyclonal antibody

Sign In for Pricing
View Details
TOP2A (phospho-S1106) polyclonal antibody
BS64291-02 100 µL

TOP2A (phospho-S1106) polyclonal antibody

Sign In for Pricing
View Details
GIPC1 (PDZ Domain-Containing Protein GIPC1, GIPC PDZ Domain Containing Family, Member 1)
481799 100 µL

GIPC1 (PDZ Domain-Containing Protein GIPC1, GIPC PDZ Domain Containing Family, Member 1)

Sign In for Pricing
View Details