Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NFASC protein

This Human NFASC protein spans the amino acid sequence from region 1239-1347aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NFASC

UniProt

O94856

Expression Region

1239-1347aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Cytoplasmic domain of His-tag and expression region is 1239-1347aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAIYSLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA1 siRNA (Human)
MBS8212562-01 15 nmol

GOLGA1 siRNA (Human)

Sign In for Pricing
View Details
GOLGA1 siRNA (Human)
MBS8212562-02 30 nmol

GOLGA1 siRNA (Human)

Sign In for Pricing
View Details
GOLGA1 siRNA (Human)
MBS8212562-03 5x 30 nmol

GOLGA1 siRNA (Human)

Sign In for Pricing
View Details
Rat Dyn (Big Dynorphin) ELISA Kit
ER21744 96 Tests

Rat Dyn (Big Dynorphin) ELISA Kit

Sign In for Pricing
View Details
CRBN ligand-443
HY-W952742 1 Each

CRBN ligand-443

Sign In for Pricing
View Details
Phospho-EGFR (Tyr1197) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2412179 100 µL

Phospho-EGFR (Tyr1197) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details