Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NFASC protein

This Human NFASC protein spans the amino acid sequence from region 1239-1347aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NFASC

UniProt

O94856

Expression Region

1239-1347aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Cytoplasmic domain of His-tag and expression region is 1239-1347aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAIYSLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRNE (Acetylcholine Receptor Subunit epsilon, ACHRE) (AP) discontinued
124981-AP 100 µL

CHRNE (Acetylcholine Receptor Subunit epsilon, ACHRE) (AP) discontinued

Sign In for Pricing
View Details
RGMB Antibody (C-term)
MBS9206084-01 0.08 mL

RGMB Antibody (C-term)

Sign In for Pricing
View Details
RGMB Antibody (C-term)
MBS9206084-02 0.4 mL

RGMB Antibody (C-term)

Sign In for Pricing
View Details
RGMB Antibody (C-term)
MBS9206084-03 5x 0.4 mL

RGMB Antibody (C-term)

Sign In for Pricing
View Details
(2-Hydroxypropyl) -β-cyclodextrin (HP-β-CD)
C10409-25mg 25 mg

(2-Hydroxypropyl) -β-cyclodextrin (HP-β-CD)

Sign In for Pricing
View Details
PDCoV NSP7 Rabbit Polyclonal Antibody
orb2950585-01 50 µg

PDCoV NSP7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details