Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFA3 protein

This Human NDUFA3 protein spans the amino acid sequence from region 2-84aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NDUFA3

UniProt

O95167

Expression Region

2-84aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 2-84aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX7 (NM_001135254) Human Over-expression Lysate
E45H01974-2 20 µg

PAX7 (NM_001135254) Human Over-expression Lysate

Sign In for Pricing
View Details
Nek1 ORF Vector (Mouse) (pORF)
ORF051214 1.0 µg DNA

Nek1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Olr792 (NM_001000378) Rat Tagged Lenti ORF Clone
RR202942L3 10 µg

Olr792 (NM_001000378) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Laminin Nonapeptide Amide
PE-102036-01 1 mg

Laminin Nonapeptide Amide

Sign In for Pricing
View Details
Laminin Nonapeptide Amide
PE-102036-02 5 mg

Laminin Nonapeptide Amide

Sign In for Pricing
View Details
Laminin Nonapeptide Amide
PE-102036-03 10 mg

Laminin Nonapeptide Amide

Sign In for Pricing
View Details