Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NAPRT1 protein

This Human NAPRT1 protein spans the amino acid sequence from region 229-538aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NAPRT1

UniProt

Q6XQN6

Expression Region

229-538aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-310aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPDL ReadyGo IHC Kit
SIHCZ-0166-01 50 Tests (No Control Slide)

HPDL ReadyGo IHC Kit

Sign In for Pricing
View Details
HPDL ReadyGo IHC Kit
SIHCZ-0166-02 50 Tests (With Control Slide)

HPDL ReadyGo IHC Kit

Sign In for Pricing
View Details
WHAL1 rabbit pAb
RA36177-01 50 µL

WHAL1 rabbit pAb

Sign In for Pricing
View Details
WHAL1 rabbit pAb
RA36177-02 100 µL

WHAL1 rabbit pAb

Sign In for Pricing
View Details
PE Fluor® 594 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
FCE1726-01 50 Tests

PE Fluor® 594 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
PE Fluor® 594 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
FCE1726-02 100 Tests

PE Fluor® 594 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details