Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NAPRT1 protein

This Human NAPRT1 protein spans the amino acid sequence from region 229-538aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NAPRT1

UniProt

Q6XQN6

Expression Region

229-538aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-310aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluor750-conjugated Polyclonal Rabbit Anti-Human IgG F (ab') 2 Secondary Antibody
APS0740-01 200 µL

Fluor750-conjugated Polyclonal Rabbit Anti-Human IgG F (ab') 2 Secondary Antibody

Sign In for Pricing
View Details
Fluor750-conjugated Polyclonal Rabbit Anti-Human IgG F (ab') 2 Secondary Antibody
APS0740-02 500 µL

Fluor750-conjugated Polyclonal Rabbit Anti-Human IgG F (ab') 2 Secondary Antibody

Sign In for Pricing
View Details
MADCAM1 Protein Vector (Rat) (pPB-C-His)
PV280686 500 ng

MADCAM1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
OR7E39P siRNA Oligos set (Human)
35612171 3x 5 nmol

OR7E39P siRNA Oligos set (Human)

Sign In for Pricing
View Details
ERK1 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61081R-PE-Cy5-01 20 µL

ERK1 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
ERK1 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61081R-PE-Cy5-02 100 µL

ERK1 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details