Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NAPRT1 protein

This Human NAPRT1 protein spans the amino acid sequence from region 229-538aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NAPRT1

UniProt

Q6XQN6

Expression Region

229-538aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-310aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCN1 Rabbit Polyclonal Antibody (Cy7)
orb1066398 100 µL

FCN1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Claudin 18 Rabbit Polyclonal Antibody
orb666322-01 30 µL

Claudin 18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 18 Rabbit Polyclonal Antibody
orb666322-02 50 μL

Claudin 18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 18 Rabbit Polyclonal Antibody
orb666322-03 100 µL

Claudin 18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 18 Rabbit Polyclonal Antibody
orb666322-04 200 µL

Claudin 18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Hyaluronic acid (HA) ELISA Kit
YP-W71185-01 48 Tests

Porcine Hyaluronic acid (HA) ELISA Kit

Sign In for Pricing
View Details