Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIAA1377 protein

This Human KIAA1377 protein spans the amino acid sequence from region 559-670aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KIAA1377

UniProt

Q9P2H0

Expression Region

559-670aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNM1P18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0619608 1.0 µg DNA

DNM1P18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Phosphatase, Alkaline, Placental (Alkaline phosphatase, placental type, Alkaline phosphatase Regan isozyme, ALP, FLJ61142, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1) (MaxLight 650)
MBS6256266-01 0.1 mL

Phosphatase, Alkaline, Placental (Alkaline phosphatase, placental type, Alkaline phosphatase Regan isozyme, ALP, FLJ61142, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1) (MaxLight 650)

Sign In for Pricing
View Details
Phosphatase, Alkaline, Placental (Alkaline phosphatase, placental type, Alkaline phosphatase Regan isozyme, ALP, FLJ61142, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1) (MaxLight 650)
MBS6256266-02 5x 0.1 mL

Phosphatase, Alkaline, Placental (Alkaline phosphatase, placental type, Alkaline phosphatase Regan isozyme, ALP, FLJ61142, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1) (MaxLight 650)

Sign In for Pricing
View Details
FKBP7 ORF Vector (Human) (pORF)
ORF004081 1.0 µg DNA

FKBP7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Akt1s1 (NM_001106259) Rat Untagged Clone
RN210065 10 µg

Akt1s1 (NM_001106259) Rat Untagged Clone

Sign In for Pricing
View Details
Rabbit Monoclonal IL-3R alpha/CD123 Antibody (7G3) [DyLight 550] - Chimeric
NBP3-20160R 0.1 mL

Rabbit Monoclonal IL-3R alpha/CD123 Antibody (7G3) [DyLight 550] - Chimeric

Sign In for Pricing
View Details