Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SH3GLB2 protein

This Human SH3GLB2 protein spans the amino acid sequence from region 1-395aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SH3GLB2

UniProt

Q9NR46

Expression Region

1-395aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cerk 3'UTR Luciferase Stable Cell Line
TU202207 1.0 mL

Cerk 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CD147 (Cluster Of Differentiation 147)
052963 200 µL

CD147 (Cluster Of Differentiation 147)

Sign In for Pricing
View Details
ASGR1 Antibody
orb2322092-01 10 µg

ASGR1 Antibody

Sign In for Pricing
View Details
ASGR1 Antibody
orb2322092-02 50 µg

ASGR1 Antibody

Sign In for Pricing
View Details
ASGR1 Antibody
orb2322092-03 100 µg

ASGR1 Antibody

Sign In for Pricing
View Details
ASGR1 Antibody
orb2322092-04 500 µg

ASGR1 Antibody

Sign In for Pricing
View Details