Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL36RN protein

This Human IL36RN protein spans the amino acid sequence from region 1-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL36RN

UniProt

Q9UBH0

Expression Region

1-155aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EFCAB10 Antibody (R4D49)
RHP10601 100 μg

Anti-EFCAB10 Antibody (R4D49)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human CSPG5 (Chondroitin sulfate proteoglycan 5) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX3965K Each

Magic™ Membrane Protein Human CSPG5 (Chondroitin sulfate proteoglycan 5) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Sign In for Pricing
View Details
NAIP Immunizing Peptide
orb17804 100 µg

NAIP Immunizing Peptide

Sign In for Pricing
View Details
Recombinant Clostridium Tetani divIB Protein (aa 55-265)
VAng-Lsx01597-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Tetani divIB Protein (aa 55-265)

Sign In for Pricing
View Details
CEP70 siRNA (Rat)
orb1827573-01 15 nmol

CEP70 siRNA (Rat)

Sign In for Pricing
View Details
CEP70 siRNA (Rat)
orb1827573-02 30 nmol

CEP70 siRNA (Rat)

Sign In for Pricing
View Details