Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FKBP14 protein

This Human FKBP14 protein spans the amino acid sequence from region 20-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FKBP14

UniProt

Q9NWM8

Expression Region

20-211aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTL2 Lentiviral Activation Particles (m2)
sc-427141-LAC-2 200 µL

CTL2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
MAP2K2 Antibody
orb571559-01 50 µg

MAP2K2 Antibody

Sign In for Pricing
View Details
MAP2K2 Antibody
orb571559-02 100 µg

MAP2K2 Antibody

Sign In for Pricing
View Details
Lentiviral human SLC13A2 sgRNA gene knockout kit - Lentiviral human SLC13A2 sgRNA gene knockout kit (100)
GTR15357679 1 Vial

Lentiviral human SLC13A2 sgRNA gene knockout kit - Lentiviral human SLC13A2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Anti-HMGN3
Y058570 100 µL

Anti-HMGN3

Sign In for Pricing
View Details
Dnm2 Antibody - N-terminal region : HRP (ARP52055_P050-HRP)
ARP52055_P050-HRP 100 µL

Dnm2 Antibody - N-terminal region : HRP (ARP52055_P050-HRP)

Sign In for Pricing
View Details