Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FKBP14 protein

This Human FKBP14 protein spans the amino acid sequence from region 20-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FKBP14

UniProt

Q9NWM8

Expression Region

20-211aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat A Disintegrin And Metalloprotease 15, ADAM15 ELISA Kit
GTR10326539 96 Well

Goat A Disintegrin And Metalloprotease 15, ADAM15 ELISA Kit

Sign In for Pricing
View Details
Zfp36l2 Mouse shRNA Plasmid (Locus ID 12193)
TR511639 1 Kit

Zfp36l2 Mouse shRNA Plasmid (Locus ID 12193)

Sign In for Pricing
View Details
Rhodopsin Colorimetric Cell-Based ELISA Kit (OKAG01017)
OKAG01017 96 Well

Rhodopsin Colorimetric Cell-Based ELISA Kit (OKAG01017)

Sign In for Pricing
View Details
rno-miR-292-5p miRNA Mimic
MBS8302703-01 5 nmol

rno-miR-292-5p miRNA Mimic

Sign In for Pricing
View Details
rno-miR-292-5p miRNA Mimic
MBS8302703-02 10 nmol

rno-miR-292-5p miRNA Mimic

Sign In for Pricing
View Details
rno-miR-292-5p miRNA Mimic
MBS8302703-03 5x 10 nmol

rno-miR-292-5p miRNA Mimic

Sign In for Pricing
View Details