Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AASDHPPT protein

This Human AASDHPPT protein spans the amino acid sequence from region 1-309aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AASDHPPT

UniProt

Q9NRN7

Expression Region

1-309aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal INO80E Antibody [DyLight 650]
NBP2-98592C 0.1 mL

Rabbit Polyclonal INO80E Antibody [DyLight 650]

Sign In for Pricing
View Details
MKX Double Nickase Plasmid (m2)
sc-431704-NIC-2 20 µg

MKX Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Anti-NDUFS8 Antibody Picoband®
A08275-2 100 µg/Vial

Anti-NDUFS8 Antibody Picoband®

Sign In for Pricing
View Details
SARS-CoV-2 B.1.1.529 (Omicron) Spike S1 Protein (His Tag)
E45O55023M2-100 100 µg

SARS-CoV-2 B.1.1.529 (Omicron) Spike S1 Protein (His Tag)

Sign In for Pricing
View Details
MED8 Antibody
CSB-PA006810-01 50 µg

MED8 Antibody

Sign In for Pricing
View Details
MED8 Antibody
CSB-PA006810-02 100 µg

MED8 Antibody

Sign In for Pricing
View Details