Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MRPL55 protein

This Human MRPL55 protein spans the amino acid sequence from region 34-128aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRPL55

UniProt

Q7Z7F7

Expression Region

34-128aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 34-128aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPRA1 Protein Vector (Human) (pPM-C-His)
PV136765 500 ng

TPRA1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
DL-2-Amino-5-guanidino-N-valeric acid hydrochloride monohydrate 98%
A22355-01 1 g

DL-2-Amino-5-guanidino-N-valeric acid hydrochloride monohydrate 98%

Sign In for Pricing
View Details
DL-2-Amino-5-guanidino-N-valeric acid hydrochloride monohydrate 98%
A22355-02 5 g

DL-2-Amino-5-guanidino-N-valeric acid hydrochloride monohydrate 98%

Sign In for Pricing
View Details
DL-2-Amino-5-guanidino-N-valeric acid hydrochloride monohydrate 98%
A22355-03 25 g

DL-2-Amino-5-guanidino-N-valeric acid hydrochloride monohydrate 98%

Sign In for Pricing
View Details
GAPDH (Glyceraldehyde-3-phosphate Dehydrogenase, Peptidyl-cysteine S-nitrosylase GAPDH, GAPD, CDABP0047, OK/SW-cl.12, G3PD, MGC88685) (MaxLight 750) discontinued
127162-ML750 100 µL

GAPDH (Glyceraldehyde-3-phosphate Dehydrogenase, Peptidyl-cysteine S-nitrosylase GAPDH, GAPD, CDABP0047, OK/SW-cl.12, G3PD, MGC88685) (MaxLight 750) discontinued

Sign In for Pricing
View Details
KRN 633
S1557-10mg 10 mg

KRN 633

Sign In for Pricing
View Details