Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MRPL54 protein

This Human MRPL54 protein spans the amino acid sequence from region 15-138aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRPL54

UniProt

Q6P161

Expression Region

15-138aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 15-138aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZNF679 sgRNA gene knockout kit - Lentiviral human ZNF679 sgRNA gene knockout kit (plasmid)
GTR15374036 1 Vial

Lentiviral human ZNF679 sgRNA gene knockout kit - Lentiviral human ZNF679 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
N-Desethyl amodiaquine-d5
HY-128554S-01 1 mg

N-Desethyl amodiaquine-d5

Sign In for Pricing
View Details
N-Desethyl amodiaquine-d5
HY-128554S-02 5 mg

N-Desethyl amodiaquine-d5

Sign In for Pricing
View Details
Pdap1 Rat shRNA Plasmid (Locus ID 64527)
TR710759 1 Kit

Pdap1 Rat shRNA Plasmid (Locus ID 64527)

Sign In for Pricing
View Details
PIK3CB Antibody, HRP conjugated
CSB-PA017999LB01HU-01 50 µg

PIK3CB Antibody, HRP conjugated

Sign In for Pricing
View Details
PIK3CB Antibody, HRP conjugated
CSB-PA017999LB01HU-02 100 µg

PIK3CB Antibody, HRP conjugated

Sign In for Pricing
View Details