Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MRPL54 protein

This Human MRPL54 protein spans the amino acid sequence from region 15-138aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRPL54

UniProt

Q6P161

Expression Region

15-138aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 15-138aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTLL4 Antibody
orb1269510 400 μl

TTLL4 Antibody

Sign In for Pricing
View Details
Recombinant Human NKX2-1 Protein, N-GST
orb2968512-01 50 µg

Recombinant Human NKX2-1 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human NKX2-1 Protein, N-GST
orb2968512-02 100 µg

Recombinant Human NKX2-1 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human NKX2-1 Protein, N-GST
orb2968512-03 1 mg

Recombinant Human NKX2-1 Protein, N-GST

Sign In for Pricing
View Details
Tcfap2a siRNA Oligos set (Rat)
68119176 3x 5 nmol

Tcfap2a siRNA Oligos set (Rat)

Sign In for Pricing
View Details
PE/Cy7 Anti-human CD94 Antibody *HP-3D9*
109401O1-AAT 100 Tests

PE/Cy7 Anti-human CD94 Antibody *HP-3D9*

Sign In for Pricing
View Details