Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EXO5 protein

This Human EXO5 protein spans the amino acid sequence from region 1-373aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EXO5

UniProt

Q9H790

Expression Region

1-373aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESKALVNMPGPSSESLGKDDKPISLQNWKRGLDILSPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEKAAVLDTGASIHLARELELHDLVTVPVTTKEDAWAIKFLNILLLIPTLQSEGHIREFPVFGEGEGVLLVGVIDELHYTAKGELELAELKTRRRPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEYIHQETATVLGTEIVAFKEKEVRAKVQHYMAYWMGHREPQGVDVEEAWKCRTCTYADICEWRKGSGVLSSTLAPQVKKAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CENPA sgRNA gene knockout kit - Lentiviral human CENPA sgRNA gene knockout kit (plasmid)
GTR15356531 1 Vial

Lentiviral human CENPA sgRNA gene knockout kit - Lentiviral human CENPA sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
ALDH4A1, CT (Aldehyde Dehydrogenase Family 4 Member A1, Delta-1-pyrroline-5-carboxylate Dehydrogenase, Mitochondrial, P5C Dehydrogenase, ALDH4, P5CDH) (Biotin) discontinued
A1334-35B-Biotin 200 µL

ALDH4A1, CT (Aldehyde Dehydrogenase Family 4 Member A1, Delta-1-pyrroline-5-carboxylate Dehydrogenase, Mitochondrial, P5C Dehydrogenase, ALDH4, P5CDH) (Biotin) discontinued

Sign In for Pricing
View Details
Bovine 17-Hydroxyprogesterone,17-OHP ELISA KIT
JOT-EKA0081BO 96 wells

Bovine 17-Hydroxyprogesterone,17-OHP ELISA KIT

Sign In for Pricing
View Details
1-​ (N-​Boc) ​-​3-​cyanoazetidine
408429-01 1 g

1-​ (N-​Boc) ​-​3-​cyanoazetidine

Sign In for Pricing
View Details
1-​ (N-​Boc) ​-​3-​cyanoazetidine
408429-02 5 g

1-​ (N-​Boc) ​-​3-​cyanoazetidine

Sign In for Pricing
View Details
Monkey Squalene Epoxidase ELISA Kit
MBS094567-01 48 Well

Monkey Squalene Epoxidase ELISA Kit

Sign In for Pricing
View Details