Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EXO5 protein

This Human EXO5 protein spans the amino acid sequence from region 1-373aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EXO5

UniProt

Q9H790

Expression Region

1-373aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESKALVNMPGPSSESLGKDDKPISLQNWKRGLDILSPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEKAAVLDTGASIHLARELELHDLVTVPVTTKEDAWAIKFLNILLLIPTLQSEGHIREFPVFGEGEGVLLVGVIDELHYTAKGELELAELKTRRRPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEYIHQETATVLGTEIVAFKEKEVRAKVQHYMAYWMGHREPQGVDVEEAWKCRTCTYADICEWRKGSGVLSSTLAPQVKKAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Α-enolase) Rat ELISA Kit
B4125 96 Tests

Α-enolase) Rat ELISA Kit

Sign In for Pricing
View Details
Caprisil CN/RP HPLC Column, 5 µm, 100 Å, CE553-CN/RP x 250 mm
CE453-CN/RP 5 µm

Caprisil CN/RP HPLC Column, 5 µm, 100 Å, CE553-CN/RP x 250 mm

Sign In for Pricing
View Details
RCC2, ID (RCC2, KIAA1470, TD60, Protein RCC2, RCC1-like protein TD-60, Telophase disk protein of 60kD) (Azide free) (HRP) discontinued
040920-HRP 200 µL

RCC2, ID (RCC2, KIAA1470, TD60, Protein RCC2, RCC1-like protein TD-60, Telophase disk protein of 60kD) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
COPE Rabbit Polyclonal Antibody (Cy3)
orb985835 100 µL

COPE Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
FSHB Conjugated Antibody
MBS9452174-01 0.1 mL (Biotin)

FSHB Conjugated Antibody

Sign In for Pricing
View Details
FSHB Conjugated Antibody
MBS9452174-02 0.1 mL (AF350)

FSHB Conjugated Antibody

Sign In for Pricing
View Details