Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MRPL20 protein

This Human MRPL20 protein spans the amino acid sequence from region 46-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRPL20

UniProt

Q9BYC9

Expression Region

46-149aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOB3B Recombinant Protein (Human)
RP075474 100 µg

MOB3B Recombinant Protein (Human)

Sign In for Pricing
View Details
Hsa-miR-124-5p inhibitor
HY-RI00143-01 5 nmol

Hsa-miR-124-5p inhibitor

Sign In for Pricing
View Details
Hsa-miR-124-5p inhibitor
HY-RI00143-02 20 nmol

Hsa-miR-124-5p inhibitor

Sign In for Pricing
View Details
CHEK1, Phosphorylated (S317) (Cell Cycle Checkpoint Kinase, CHK1) (APC)
MBS6411515-01 0.1 mL

CHEK1, Phosphorylated (S317) (Cell Cycle Checkpoint Kinase, CHK1) (APC)

Sign In for Pricing
View Details
CHEK1, Phosphorylated (S317) (Cell Cycle Checkpoint Kinase, CHK1) (APC)
MBS6411515-02 5x 0.1 mL

CHEK1, Phosphorylated (S317) (Cell Cycle Checkpoint Kinase, CHK1) (APC)

Sign In for Pricing
View Details
C1DP4 Protein Vector (Human) (pPM-C-His)
PV066084 500 ng

C1DP4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details