Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MRPL20 protein

This Human MRPL20 protein spans the amino acid sequence from region 46-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRPL20

UniProt

Q9BYC9

Expression Region

46-149aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Follistatin Like Protein 3 ELISA Kit
MBS7264728-01 48 Well

Chicken Follistatin Like Protein 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Follistatin Like Protein 3 ELISA Kit
MBS7264728-02 96 Well

Chicken Follistatin Like Protein 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Follistatin Like Protein 3 ELISA Kit
MBS7264728-03 5x 96 Well

Chicken Follistatin Like Protein 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Follistatin Like Protein 3 ELISA Kit
MBS7264728-04 10x 96 Well

Chicken Follistatin Like Protein 3 ELISA Kit

Sign In for Pricing
View Details
Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit
MBS730873-01 48 Well

Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit

Sign In for Pricing
View Details
Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit
MBS730873-02 96 Well

Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit

Sign In for Pricing
View Details