Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MRPL20 protein

This Human MRPL20 protein spans the amino acid sequence from region 46-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRPL20

UniProt

Q9BYC9

Expression Region

46-149aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCTAIRE2 (CDK17) (NM_002595) Human Over-expression Lysate
LS005128 100 µg

PCTAIRE2 (CDK17) (NM_002595) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Anti-Sheep IgG (H&L) - AcalephFluor532
CSA3330-01 100 µL

Rabbit Anti-Sheep IgG (H&L) - AcalephFluor532

Sign In for Pricing
View Details
Rabbit Anti-Sheep IgG (H&L) - AcalephFluor532
CSA3330-02 500 μL

Rabbit Anti-Sheep IgG (H&L) - AcalephFluor532

Sign In for Pricing
View Details
Rabbit Anti-Sheep IgG (H&L) - AcalephFluor532
CSA3330-03 1 mL

Rabbit Anti-Sheep IgG (H&L) - AcalephFluor532

Sign In for Pricing
View Details
hsa-miR-6506-5p miRNA Agomir
MBS8312692-01 5 nmol

hsa-miR-6506-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-6506-5p miRNA Agomir
MBS8312692-02 10 nmol

hsa-miR-6506-5p miRNA Agomir

Sign In for Pricing
View Details