Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DBNDD2 protein

This Human DBNDD2 protein spans the amino acid sequence from region 1-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DBNDD2

UniProt

Q9BQY9

Expression Region

1-161aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zdhhc20 (NM_029492) AAV Particle
MR205665A1V 250 µL

Mouse Zdhhc20 (NM_029492) AAV Particle

Sign In for Pricing
View Details
B7-1/CD80 ELISA Kit (Mouse) (OKBB00310)
OKBB00310 96 Tests

B7-1/CD80 ELISA Kit (Mouse) (OKBB00310)

Sign In for Pricing
View Details
NGF Protein, Human, Recombinant
MBS8120658-01 0.1 mg

NGF Protein, Human, Recombinant

Sign In for Pricing
View Details
NGF Protein, Human, Recombinant
MBS8120658-02 5x 0.1 mg

NGF Protein, Human, Recombinant

Sign In for Pricing
View Details
SCAF-FR-STSH-368-SLIT-A Scafftag Tagging System Kits
831443 1 Pack (1 Kit x 1 Pack)

SCAF-FR-STSH-368-SLIT-A Scafftag Tagging System Kits

Sign In for Pricing
View Details
Slc43a2 sgRNA CRISPR Lentivector set (Mouse)
K4724301 3x 1.0 µg

Slc43a2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details