Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Mmp7 protein

This Rat Mmp7 protein spans the amino acid sequence from region 98-267aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mmp7

UniProt

P50280

Expression Region

98-267aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 98-267aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clusterin (Clusterin Precursor, CLU, AAG4, Apolipoprotein J, APOJ, Apo-J, CLI, Complement-associated Protein SP-40, Complement Cytolysis Inhibitor, KUB1, MGC24903, NA1/NA2, SGP2, SGP-2, SP-40, Testosterone-repressed Prostate Message 2, TRPM2, TRPM-2) (AP) discontinued
C5870-01G-AP 100 µL

Clusterin (Clusterin Precursor, CLU, AAG4, Apolipoprotein J, APOJ, Apo-J, CLI, Complement-associated Protein SP-40, Complement Cytolysis Inhibitor, KUB1, MGC24903, NA1/NA2, SGP2, SGP-2, SP-40, Testosterone-repressed Prostate Message 2, TRPM2, TRPM-2) (AP) discontinued

Sign In for Pricing
View Details
EHMT2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
19058064 1.0 µg DNA

EHMT2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila nqrD Protein (aa 1-210)
VAng-Lsx0648-inquire Inquire

Recombinant Aeromonas Hydrophila nqrD Protein (aa 1-210)

Sign In for Pricing
View Details
NDUFB7 Antibody, FITC conjugated
CSB-PA01594C0Rb-01 50 µg

NDUFB7 Antibody, FITC conjugated

Sign In for Pricing
View Details
NDUFB7 Antibody, FITC conjugated
CSB-PA01594C0Rb-02 100 µg

NDUFB7 Antibody, FITC conjugated

Sign In for Pricing
View Details
PEPCK M Antibody, mAb, Rabbit
A03956-100 100 µL

PEPCK M Antibody, mAb, Rabbit

Sign In for Pricing
View Details