Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ERP44 protein

This Human ERP44 protein spans the amino acid sequence from region 30-406aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ERP44

UniProt

Q9BS26

Expression Region

30-406aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPTX2 Human Pre-designed siRNA Set A
HY-RS09506 1 Set

NPTX2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human RUNX3/CBFA3 Recombinant Protein
PROTQ13761-01 10 µg

Human RUNX3/CBFA3 Recombinant Protein

Sign In for Pricing
View Details
Human RUNX3/CBFA3 Recombinant Protein
PROTQ13761-02 50 µg

Human RUNX3/CBFA3 Recombinant Protein

Sign In for Pricing
View Details
Human RUNX3/CBFA3 Recombinant Protein
PROTQ13761-03 100 µg

Human RUNX3/CBFA3 Recombinant Protein

Sign In for Pricing
View Details
Human RUNX3/CBFA3 Recombinant Protein
PROTQ13761-04 250 µg

Human RUNX3/CBFA3 Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Olfml1 shRNA (UAS) - Lentiviral mouse Olfml1 shRNA (UAS) (25)
GTR15286277 1 Vial

Lentiviral mouse Olfml1 shRNA (UAS) - Lentiviral mouse Olfml1 shRNA (UAS) (25)

Sign In for Pricing
View Details