Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HSD17B10 protein

This Human HSD17B10 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HSD17B10

UniProt

Q99714

Expression Region

2-261aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quantifoil R 1/4 ; Gold 400 Mesh 100/pk
M-CEM-Q450AR14 100 Grids

Quantifoil R 1/4 ; Gold 400 Mesh 100/pk

Sign In for Pricing
View Details
Mouse STUB1 (E3 ubiquitin-protein ligase CHIP) ELISA Kit
EM1381 96 Tests

Mouse STUB1 (E3 ubiquitin-protein ligase CHIP) ELISA Kit

Sign In for Pricing
View Details
Human NACC1 Pre-designed siRNA Set B
SI010220B 1 Each

Human NACC1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
RIN1 Blocking Peptide
CBP2408-01 1 mg

RIN1 Blocking Peptide

Sign In for Pricing
View Details
RIN1 Blocking Peptide
CBP2408-02 5 mg

RIN1 Blocking Peptide

Sign In for Pricing
View Details
PACAP (1-38) free acid TFA
T81571-01 5 mg

PACAP (1-38) free acid TFA

Sign In for Pricing
View Details