Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HSD17B10 protein

This Human HSD17B10 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HSD17B10

UniProt

Q99714

Expression Region

2-261aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAS2 Polyclonal Antibody, PerCP Conjugated
bs-11290R-PerCP 100 µL

HAS2 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Rat Spats2 Pre-designed siRNA Set B
SI213618B 1 Each

Rat Spats2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-CD90/Thy-1 Polyclonal Antibody
TMAB-04097-01 50 μL

Anti-CD90/Thy-1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD90/Thy-1 Polyclonal Antibody
TMAB-04097-02 100 µL

Anti-CD90/Thy-1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD90/Thy-1 Polyclonal Antibody
TMAB-04097-03 200 µL

Anti-CD90/Thy-1 Polyclonal Antibody

Sign In for Pricing
View Details
LDLRAD3 , Human (HEK293, hFc)
HY-P77057A-01 5 µg

LDLRAD3 , Human (HEK293, hFc)

Sign In for Pricing
View Details