Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIP3 beta protein

This Human MIP3 beta protein spans the amino acid sequence from region 22-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta chemokine exodus 3 protein, C C motif chemokine 19 protein, CCL19 protein, CK beta 11 protein, CKb11 protein, EBI1 ligand chemokine protein, ELC protein, MIP 3 beta protein, MIP 3b protein, MIP3B protein, MIP-3-beta protein, SCYA19 protein, Small inducible cytokine A19 protein, MIP-3-beta protein, MIP3beta protein

UniProt

Q99731

Expression Region

22-98aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Campylobacter jejuni (C. jejuni) (APC)
MBS6268280-01 0.1 mL

Campylobacter jejuni (C. jejuni) (APC)

Sign In for Pricing
View Details
Campylobacter jejuni (C. jejuni) (APC)
MBS6268280-02 5x 0.1 mL

Campylobacter jejuni (C. jejuni) (APC)

Sign In for Pricing
View Details
GlnS Antibody
orb833070 2 mg

GlnS Antibody

Sign In for Pricing
View Details
SLC23A1 Antibody (HRP)
orb356738-01 50 µg

SLC23A1 Antibody (HRP)

Sign In for Pricing
View Details
SLC23A1 Antibody (HRP)
orb356738-02 100 µg

SLC23A1 Antibody (HRP)

Sign In for Pricing
View Details
ELF4 Rabbit Polyclonal Antibody (Biotin)
orb2129707 100 µL

ELF4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details