Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mcl1 protein

This Mouse Mcl1 protein spans the amino acid sequence from region 1-308aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mcl1

UniProt

P97287

Expression Region

1-308aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-331aa of His-SUMO-tag and expression region is 1-308aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRPG Human Over-expression Lysate
orb1341503 100 µg

SIRPG Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Human BDNF Antibody (SAA0471)
ARO-A15500-01 50 µg

Anti-Human BDNF Antibody (SAA0471)

Sign In for Pricing
View Details
Anti-Human BDNF Antibody (SAA0471)
ARO-A15500-02 100 µg

Anti-Human BDNF Antibody (SAA0471)

Sign In for Pricing
View Details
Anti-Human BDNF Antibody (SAA0471)
ARO-A15500-03 1 mg

Anti-Human BDNF Antibody (SAA0471)

Sign In for Pricing
View Details
CDC42 Rabbit Polyclonal Antibody (Cy5.5)
orb1047517 100 µL

CDC42 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
B-Raf polyclonal antibody
orb1721322-01 50 µL

B-Raf polyclonal antibody

Sign In for Pricing
View Details