Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSMF1 protein

This Human PSMF1 protein spans the amino acid sequence from region 1-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PSMF1

UniProt

Q92530

Expression Region

1-271aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytochrome c Antibody
CQA0177-01 30 µL

Anti-Cytochrome c Antibody

Sign In for Pricing
View Details
Anti-Cytochrome c Antibody
CQA0177-02 50 μL

Anti-Cytochrome c Antibody

Sign In for Pricing
View Details
Anti-Cytochrome c Antibody
CQA0177-03 100 µL

Anti-Cytochrome c Antibody

Sign In for Pricing
View Details
Anti-Cytochrome c Antibody
CQA0177-04 200 µL

Anti-Cytochrome c Antibody

Sign In for Pricing
View Details
MAL Protein Vector (Rat) (pPB-C-His)
PV280822 500 ng

MAL Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
AP2A2 Rabbit Polyclonal Antibody (HRP)
orb2097941 100 µL

AP2A2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details