Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FIBIN protein

This Human FIBIN protein spans the amino acid sequence from region 19-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FIBIN

UniProt

Q8TAL6

Expression Region

19-211aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TB CFP10 Antigen
E61H01304 100ug

TB CFP10 Antigen

Sign In for Pricing
View Details
Rabbit Anti-CD72 antibody
SL2517R-01 50 µL

Rabbit Anti-CD72 antibody

Sign In for Pricing
View Details
Rabbit Anti-CD72 antibody
SL2517R-02 100 µL

Rabbit Anti-CD72 antibody

Sign In for Pricing
View Details
ZSCAN23 Protein Vector (Human) (pPM-C-HA)
PV146024 500 ng

ZSCAN23 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Modified Human Tubal Fluid (HTF) with HEPES
TBS8072C 50 mL

Modified Human Tubal Fluid (HTF) with HEPES

Sign In for Pricing
View Details
LDOC1 CRISPR Activation Plasmid (m)
sc-436697-ACT 20 µg

LDOC1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details