E.coli FCGRT protein
This E.coli FCGRT protein spans the amino acid sequence from region 24-297aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Alpha chain protein, Fc fragment of IgG, receptor transporter, alpha protein, FCGRT protein, FcRn alpha chain protein, FCRN protein, FCRN, alpha chain protein, IgG Fc fragment receptor transporter alpha chain protein, IgG Gc receptor protein, IgG receptor FcRn large subunit p51 protein, IgG receptor FcRn large subunit p51 precursor protein, Immunoglobulin receptor, intestinal, heavy chain protein, Neonatal Fc receptor protein, IgG R FcRn large subunit p51 protein
UniProt
Q8SPV9
Expression Region
24-297aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
46.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
