Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DAND5 protein

This Human DAND5 protein spans the amino acid sequence from region 23-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DAND5

UniProt

Q8N907

Expression Region

23-189aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plastin L (LCP1) (NM_002298) Human Tagged Lenti ORF Clone
RC201670L1 10 µg

Plastin L (LCP1) (NM_002298) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
N6-Propionyl Cordycepin
sc-208082 5 mg

N6-Propionyl Cordycepin

Sign In for Pricing
View Details
Human SLC7A13 Knockout HEK293T cell line
GTR15414331 1 Vial

Human SLC7A13 Knockout HEK293T cell line

Sign In for Pricing
View Details
Ku80 (XRCC5) Rabbit Polyclonal Antibody
TA324453 400 µL

Ku80 (XRCC5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
General Serum Diluent
MBS258402-01 100 mL

General Serum Diluent

Sign In for Pricing
View Details
General Serum Diluent
MBS258402-02 500 mL

General Serum Diluent

Sign In for Pricing
View Details