Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DAND5 protein

This Human DAND5 protein spans the amino acid sequence from region 23-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DAND5

UniProt

Q8N907

Expression Region

23-189aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

INTS6 Antibody, FITC conjugated
CSB-PA011764LC01HU-01 50 µg

INTS6 Antibody, FITC conjugated

Sign In for Pricing
View Details
INTS6 Antibody, FITC conjugated
CSB-PA011764LC01HU-02 100 µg

INTS6 Antibody, FITC conjugated

Sign In for Pricing
View Details
LMO4 Antibody
MBS7045514-01 0.05 mL

LMO4 Antibody

Sign In for Pricing
View Details
LMO4 Antibody
MBS7045514-02 0.1 mL

LMO4 Antibody

Sign In for Pricing
View Details
LMO4 Antibody
MBS7045514-03 5x 0.1 mL

LMO4 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Rift Valley Fever Virus Antibody [DyLight 650]
NBP2-41081C 0.1 mL

Rabbit Polyclonal Rift Valley Fever Virus Antibody [DyLight 650]

Sign In for Pricing
View Details