Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DAND5 protein

This Human DAND5 protein spans the amino acid sequence from region 23-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DAND5

UniProt

Q8N907

Expression Region

23-189aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRAS siRNA (Mouse)
MBS8212400-01 15 nmol

KRAS siRNA (Mouse)

Sign In for Pricing
View Details
KRAS siRNA (Mouse)
MBS8212400-02 30 nmol

KRAS siRNA (Mouse)

Sign In for Pricing
View Details
KRAS siRNA (Mouse)
MBS8212400-03 5x 30 nmol

KRAS siRNA (Mouse)

Sign In for Pricing
View Details
C5a Receptor agonist, mouse, human
orb2277216-01 5 mg

C5a Receptor agonist, mouse, human

Sign In for Pricing
View Details
C5a Receptor agonist, mouse, human
orb2277216-02 50 mg

C5a Receptor agonist, mouse, human

Sign In for Pricing
View Details
Sheep Nuclear Factor, Erythroid Derived 2 Like Protein 2 ELISA Kit
MBS086491-01 48 Well

Sheep Nuclear Factor, Erythroid Derived 2 Like Protein 2 ELISA Kit

Sign In for Pricing
View Details