Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHCHD4 protein

This Human CHCHD4 protein spans the amino acid sequence from region 1-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHCHD4

UniProt

Q8N4Q1

Expression Region

1-142aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HABP4 Rabbit Polyclonal Antibody
orb586486 100 µL

HABP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Ethyl Ester
410884-01 2.5 mg

1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Ethyl Ester

Sign In for Pricing
View Details
1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Ethyl Ester
410884-02 5 mg

1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Ethyl Ester

Sign In for Pricing
View Details
FLJ25328 ORF Vector (Human) (pORF)
20632011 1.0 µg DNA

FLJ25328 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Olr828 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7353403 1.0 µg DNA

Olr828 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Lentiviral human TBRG4 shRNA (UAS) - Lentiviral human TBRG4 shRNA (UAS, RFP) (25)
GTR15297062 1 Vial

Lentiviral human TBRG4 shRNA (UAS) - Lentiviral human TBRG4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details