Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GALM protein

This Human GALM protein spans the amino acid sequence from region 2-342aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GALM

UniProt

Q96C23

Expression Region

2-342aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DNA polymerase alpha Catalytic subunit, POLA1 ELISA Kit
MBS9338072-01 48 Well

Mouse DNA polymerase alpha Catalytic subunit, POLA1 ELISA Kit

Sign In for Pricing
View Details
Mouse DNA polymerase alpha Catalytic subunit, POLA1 ELISA Kit
MBS9338072-02 96 Well

Mouse DNA polymerase alpha Catalytic subunit, POLA1 ELISA Kit

Sign In for Pricing
View Details
Mouse DNA polymerase alpha Catalytic subunit, POLA1 ELISA Kit
MBS9338072-03 5x 96 Well

Mouse DNA polymerase alpha Catalytic subunit, POLA1 ELISA Kit

Sign In for Pricing
View Details
Mouse DNA polymerase alpha Catalytic subunit, POLA1 ELISA Kit
MBS9338072-04 10x 96 Well

Mouse DNA polymerase alpha Catalytic subunit, POLA1 ELISA Kit

Sign In for Pricing
View Details
K Cadherin Blocking Peptide
CBP5415-01 1 mg

K Cadherin Blocking Peptide

Sign In for Pricing
View Details
K Cadherin Blocking Peptide
CBP5415-02 5 mg

K Cadherin Blocking Peptide

Sign In for Pricing
View Details