Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LRP4 protein

This Human LRP4 protein spans the amino acid sequence from region 1747-1905aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LRP4

UniProt

O75096

Expression Region

1747-1905aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Cytoplasmic domain of His-tag and expression region is 1747-1905aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue, Section, Human Tumor, Pancreas Tumor, Adenocarcinoma (Paraffin)
MBS640611-01 5 Sections

Tissue, Section, Human Tumor, Pancreas Tumor, Adenocarcinoma (Paraffin)

Sign In for Pricing
View Details
Tissue, Section, Human Tumor, Pancreas Tumor, Adenocarcinoma (Paraffin)
MBS640611-02 5x 5 Sections

Tissue, Section, Human Tumor, Pancreas Tumor, Adenocarcinoma (Paraffin)

Sign In for Pricing
View Details
Anti-TMEM208 Antibody Picoband® Fluoro550 Conjugated
A16438-Fluoro550 100 µg/Vial

Anti-TMEM208 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Caprisil C18-XS HPLC Column, 5 µm, 100 Å, CA555-C18-XS x 50 mm
CA555-C18-XS 5 µm

Caprisil C18-XS HPLC Column, 5 µm, 100 Å, CA555-C18-XS x 50 mm

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) Antibody
orb1461218-01 20 µg

CD11c (Dendritic Cell Marker) Antibody

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) Antibody
orb1461218-02 100 µg

CD11c (Dendritic Cell Marker) Antibody

Sign In for Pricing
View Details