Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LRP4 protein

This Human LRP4 protein spans the amino acid sequence from region 1747-1905aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LRP4

UniProt

O75096

Expression Region

1747-1905aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Cytoplasmic domain of His-tag and expression region is 1747-1905aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-PODXL-sgRNA3-Cas9-EGFP-Puro Plasmid
PVT78446 2 µg

PLV3-U6-PODXL-sgRNA3-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Benzyl β-D-glucopyranosiduronic acid
MB158660-01 0.1 g

Benzyl β-D-glucopyranosiduronic acid

Sign In for Pricing
View Details
Benzyl β-D-glucopyranosiduronic acid
MB158660-02 10 g

Benzyl β-D-glucopyranosiduronic acid

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Connexin 31 (CX31)
MBS2055504-01 0.1 mL

FITC-Linked Polyclonal Antibody to Connexin 31 (CX31)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Connexin 31 (CX31)
MBS2055504-02 0.2 mL

FITC-Linked Polyclonal Antibody to Connexin 31 (CX31)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Connexin 31 (CX31)
MBS2055504-03 0.5 mL

FITC-Linked Polyclonal Antibody to Connexin 31 (CX31)

Sign In for Pricing
View Details