Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LRBA protein

This Human LRBA protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LRBA BGL CDC4L LBA

UniProt

P50851

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 2-2863aa of His-tag and expression region is 1-251aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASEDNRVPSPPPTGDDGGGGGREETPTEGGALSLKPGLPIRGIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402629 10 µg

PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone

Sign In for Pricing
View Details
PRKAB2 3'UTR Luciferase Stable Cell Line
TU018813 1.0 mL

PRKAB2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Ttc29 qPCR Primer Pair
QM41934S 200 Tests

Mouse Ttc29 qPCR Primer Pair

Sign In for Pricing
View Details
CMKLR2 Rabbit Polyclonal Antibody (Biotin)
orb2818211 100 µg

CMKLR2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
RAI14 (Ankycorbin, Retinoic Acid Induced 14)
490028 100 µL

RAI14 (Ankycorbin, Retinoic Acid Induced 14)

Sign In for Pricing
View Details
Dihydrolipoyl Dehydrogenase mitochondrial (DLD) Rat ELISA Kit
C8953 96 Tests

Dihydrolipoyl Dehydrogenase mitochondrial (DLD) Rat ELISA Kit

Sign In for Pricing
View Details