Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LRBA protein

This Human LRBA protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LRBA BGL CDC4L LBA

UniProt

P50851

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 2-2863aa of His-tag and expression region is 1-251aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASEDNRVPSPPPTGDDGGGGGREETPTEGGALSLKPGLPIRGIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Pappalysin-1 (PAPP1), partial
orb3007441-01 20 µg

Recombinant Human Pappalysin-1 (PAPP1), partial

Sign In for Pricing
View Details
Recombinant Human Pappalysin-1 (PAPP1), partial
orb3007441-02 100 µg

Recombinant Human Pappalysin-1 (PAPP1), partial

Sign In for Pricing
View Details
Recombinant Human Pappalysin-1 (PAPP1), partial
orb3007441-03 1 mg

Recombinant Human Pappalysin-1 (PAPP1), partial

Sign In for Pricing
View Details
Alkaline Phosphatase/ALPL Rabbit Polyclonal Antibody (Fluoro647)
orb3084061 100 µg

Alkaline Phosphatase/ALPL Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Recombinant Human Nucleolar complex protein 2 homolog (NOC2L)
orb3004877-01 20 µg

Recombinant Human Nucleolar complex protein 2 homolog (NOC2L)

Sign In for Pricing
View Details
Recombinant Human Nucleolar complex protein 2 homolog (NOC2L)
orb3004877-02 100 µg

Recombinant Human Nucleolar complex protein 2 homolog (NOC2L)

Sign In for Pricing
View Details