Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SUCLG2 protein

This Human SUCLG2 protein spans the amino acid sequence from region 49-423aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SUCLG2

UniProt

Q96I99

Expression Region

49-423aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Ankyrin repeat and zinc finger domain-containing protein 1 (ANKZF1) ELISA Kit
MBS7236622-01 48 Well

Bovine Ankyrin repeat and zinc finger domain-containing protein 1 (ANKZF1) ELISA Kit

Sign In for Pricing
View Details
Bovine Ankyrin repeat and zinc finger domain-containing protein 1 (ANKZF1) ELISA Kit
MBS7236622-02 96 Well

Bovine Ankyrin repeat and zinc finger domain-containing protein 1 (ANKZF1) ELISA Kit

Sign In for Pricing
View Details
Bovine Ankyrin repeat and zinc finger domain-containing protein 1 (ANKZF1) ELISA Kit
MBS7236622-03 5x 96 Well

Bovine Ankyrin repeat and zinc finger domain-containing protein 1 (ANKZF1) ELISA Kit

Sign In for Pricing
View Details
Bovine Ankyrin repeat and zinc finger domain-containing protein 1 (ANKZF1) ELISA Kit
MBS7236622-04 10x 96 Well

Bovine Ankyrin repeat and zinc finger domain-containing protein 1 (ANKZF1) ELISA Kit

Sign In for Pricing
View Details
Klk9 3'UTR GFP Stable Cell Line
TU256804 1.0 mL

Klk9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PRKX, CT (Protein Kinase PKX1, Serine/Threonine-protein Kinase PRKX, PKX1) (Azide free) (HRP) discontinued
P9105-99-HRP 200 µL

PRKX, CT (Protein Kinase PKX1, Serine/Threonine-protein Kinase PRKX, PKX1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details