Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Lox protein

This Rat Lox protein spans the amino acid sequence from region 163-411aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lox

UniProt

P16636

Expression Region

163-411aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 163-411aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPYNPYKYSDDNPYYNYYDTYERPRSGSRHRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASGCTISPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-M-Ficolin (human)
ABS 036-01-04 400 µL

Anti-M-Ficolin (human)

Sign In for Pricing
View Details
Anti-Synapsin-3 Antibody (L125/18)
RHA37603 100 μg

Anti-Synapsin-3 Antibody (L125/18)

Sign In for Pricing
View Details
PAX8 (Paired Box 8) (HRP)
249769-HRP 100 µL

PAX8 (Paired Box 8) (HRP)

Sign In for Pricing
View Details
AP1S1 Antibody
orb1557807-01 50 μL

AP1S1 Antibody

Sign In for Pricing
View Details
AP1S1 Antibody
orb1557807-02 100 µL

AP1S1 Antibody

Sign In for Pricing
View Details
AP1S1 Antibody
orb1557807-03 200 µL

AP1S1 Antibody

Sign In for Pricing
View Details