Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KLRG1 protein

This Human KLRG1 protein spans the amino acid sequence from region 60-195aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KLRG1

UniProt

Q96E93

Expression Region

60-195aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM83F Human qPCR Primer Pair (NM_138435)
HP216985 200 Reactions

FAM83F Human qPCR Primer Pair (NM_138435)

Sign In for Pricing
View Details
tert-Butyl 4-Bromo-2-fluorobenzoate
TRC-B682025-5G 5 g

tert-Butyl 4-Bromo-2-fluorobenzoate

Sign In for Pricing
View Details
Progesterone Receptor (PGR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI24D6]
TA805434BM 100 µL

Progesterone Receptor (PGR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI24D6]

Sign In for Pricing
View Details
Frozen Tissue Sections, Cecum
CS521340 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
PSMA Mouse Monoclonal Antibody [A10A2]
HA601169 100 µL

PSMA Mouse Monoclonal Antibody [A10A2]

Sign In for Pricing
View Details
METTL21D (VCPKMT) Human Gene Knockout Kit (CRISPR)
KN416594 1 Kit

METTL21D (VCPKMT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details