Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KLRG1 protein

This Human KLRG1 protein spans the amino acid sequence from region 60-195aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KLRG1

UniProt

Q96E93

Expression Region

60-195aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synapsin1 (Ab-62) Antibody
8B0581-AAT 50 µg

Synapsin1 (Ab-62) Antibody

Sign In for Pricing
View Details
HRH1 Antibody
8G369-AAT 50 µg

HRH1 Antibody

Sign In for Pricing
View Details
Human LIM2 activation kit by CRISPRa
GA102697 1 Kit

Human LIM2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse IP-10/CXCL10 Antibody Pair Set
E-KAB-0552 50 µL & 100 µg

Mouse IP-10/CXCL10 Antibody Pair Set

Sign In for Pricing
View Details
Ybey (NM_172550) Mouse Tagged ORF Clone
MG201309 10 µg

Ybey (NM_172550) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant RPSA Antibody
RC-4448-01 50 μL

Recombinant RPSA Antibody

Sign In for Pricing
View Details