Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLEKHB2 protein

This Human PLEKHB2 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLEKHB2

UniProt

Q96CS7

Expression Region

1-222aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP (Fatty acid-Binding protein 3 Heart-type, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-Binding protein, M-FABP, FABP3) (MaxLight 405)
MBS6263535-01 0.1 mL

FABP (Fatty acid-Binding protein 3 Heart-type, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-Binding protein, M-FABP, FABP3) (MaxLight 405)

Sign In for Pricing
View Details
FABP (Fatty acid-Binding protein 3 Heart-type, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-Binding protein, M-FABP, FABP3) (MaxLight 405)
MBS6263535-02 5x 0.1 mL

FABP (Fatty acid-Binding protein 3 Heart-type, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-Binding protein, M-FABP, FABP3) (MaxLight 405)

Sign In for Pricing
View Details
CDC7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
15635111 3x 1.0 µg

CDC7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal DLGAP4 Antibody
NBP2-33271 0.1 mL

Rabbit Polyclonal DLGAP4 Antibody

Sign In for Pricing
View Details
SHCBP1L Rabbit Polyclonal Antibody (BF647)
orb2504384 100 µL

SHCBP1L Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
DSG3 Antibody / Desmoglein 3
V4570SAF-100UG 100 µg

DSG3 Antibody / Desmoglein 3

Sign In for Pricing
View Details