Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLEKHB2 protein

This Human PLEKHB2 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLEKHB2

UniProt

Q96CS7

Expression Region

1-222aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBL1 (TBL1X) (NM_005647) Human Tagged Lenti ORF Clone
RC213516L3 10 µg

TBL1 (TBL1X) (NM_005647) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
EEF1A2 Antibody
E51A06605 100 µL

EEF1A2 Antibody

Sign In for Pricing
View Details
Chicken Insulin Like Growth Factor 1 (IGF1) ELISA Kit
orb2667955-01 48 Tests

Chicken Insulin Like Growth Factor 1 (IGF1) ELISA Kit

Sign In for Pricing
View Details
Chicken Insulin Like Growth Factor 1 (IGF1) ELISA Kit
orb2667955-02 96 Tests

Chicken Insulin Like Growth Factor 1 (IGF1) ELISA Kit

Sign In for Pricing
View Details
HXA2 rabbit pAb Antibody
orb771900-01 50 μL

HXA2 rabbit pAb Antibody

Sign In for Pricing
View Details
HXA2 rabbit pAb Antibody
orb771900-02 100 µL

HXA2 rabbit pAb Antibody

Sign In for Pricing
View Details