Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLEKHB2 protein

This Human PLEKHB2 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLEKHB2

UniProt

Q96CS7

Expression Region

1-222aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Wingless Type MMTV Integration Site Family, Member 5B ELISA Kit
MBS088751 Inquire

Pigeon Wingless Type MMTV Integration Site Family, Member 5B ELISA Kit

Sign In for Pricing
View Details
Anti-PPM1N Antibody Picoband®, iFluor647 Conjugate
A16917-1-iFluor647 100 µg

Anti-PPM1N Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Recombinant Bacillus cereus Heme A synthase (ctaA), partial
MBS7085321 Inquire

Recombinant Bacillus cereus Heme A synthase (ctaA), partial

Sign In for Pricing
View Details
ELISpot Plus: Bovine IL-17A (HRP)
3109-4HPW-10 10 Plates

ELISpot Plus: Bovine IL-17A (HRP)

Sign In for Pricing
View Details
Jag1 3'UTR GFP Stable Cell Line
TU256464 1.0 mL

Jag1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis Elongation factor P (efp)
MBS1419719-01 0.02 mg (E-Coli)

Recombinant Zymomonas mobilis Elongation factor P (efp)

Sign In for Pricing
View Details