Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lgals7 protein

This Mouse Lgals7 protein spans the amino acid sequence from region 2-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lgals7

UniProt

O54974

Expression Region

2-136aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-136aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) (APC)
129913-APC 100 µL

MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) (APC)

Sign In for Pricing
View Details
Lentiviral human MDGA2 shRNA (UAS) - Lentiviral human MDGA2 shRNA (UAS, GFP) (100)
GTR15317844 1 Vial

Lentiviral human MDGA2 shRNA (UAS) - Lentiviral human MDGA2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
KRT81
551706 100 µg

KRT81

Sign In for Pricing
View Details
TBL1X Antibody, Biotin conjugated
CSB-PA023234LD01HU-01 50 µg

TBL1X Antibody, Biotin conjugated

Sign In for Pricing
View Details
TBL1X Antibody, Biotin conjugated
CSB-PA023234LD01HU-02 100 µg

TBL1X Antibody, Biotin conjugated

Sign In for Pricing
View Details
MAPK14 Antibody
orb1253722 0.1 mg

MAPK14 Antibody

Sign In for Pricing
View Details