Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lgals7 protein

This Mouse Lgals7 protein spans the amino acid sequence from region 2-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lgals7

UniProt

O54974

Expression Region

2-136aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-136aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RDH11 shRNA (UAS) - Lentiviral human RDH11 shRNA (UAS) (25)
GTR15099677 1 Vial

Lentiviral human RDH11 shRNA (UAS) - Lentiviral human RDH11 shRNA (UAS) (25)

Sign In for Pricing
View Details
STXBP1 (Syntaxin-binding Protein 1, Protein Unc-18 Homolog, Unc-18-1, Protein Unc-18 Homolog A, Unc-18A, N-Sec1, p67, UNC18A) (AP) discontinued
134048-AP 100 µL

STXBP1 (Syntaxin-binding Protein 1, Protein Unc-18 Homolog, Unc-18-1, Protein Unc-18 Homolog A, Unc-18A, N-Sec1, p67, UNC18A) (AP) discontinued

Sign In for Pricing
View Details
3- (Dimethoxymethyl) -1H-pyrazole
LEA57359-01 2.5 g

3- (Dimethoxymethyl) -1H-pyrazole

Sign In for Pricing
View Details
3- (Dimethoxymethyl) -1H-pyrazole
LEA57359-02 25 g

3- (Dimethoxymethyl) -1H-pyrazole

Sign In for Pricing
View Details
Anti-IDH3A Antibody Picoband®, Dylight594 Conjugate
A09544-3-Dylight594 100 µg

Anti-IDH3A Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
4-Chlorobenzene-1-diazonium, tetrafluoroboranuide
AAA67341-01 100 mg

4-Chlorobenzene-1-diazonium, tetrafluoroboranuide

Sign In for Pricing
View Details